Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA034495 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-RAB3GAP1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SACLLSDMESFKAANPGCSLEDFVRWYSPRDYIEE
EVIDEKGNVVLKGELSARMKIPSNMWVEAWETAKP
IPARRQRRLFDDTREAEKVLHYL- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions.
Xu D, Li Y, Wu L, Li Y, Zhao D, Yu J, Huang T, Ferguson C, Parton RG, Yang H, Li P
The Journal of cell biology 2018 Mar 5;217(3):975-995
The Journal of cell biology 2018 Mar 5;217(3):975-995
No comments: Submit comment
No validations: Submit validation data