Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA046430 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA046430, RRID:AB_2679662
- Product name
- Anti-TM4SF4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
INKGPKCLMANSTWGYPFHDGDYLNDEALWNKCRE
PLNVVPWN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references TM4SF4 and LRRK2 Are Potential Therapeutic Targets in Lung and Breast Cancers through Outlier Analysis
Jung K, Choi J, Koo B, Kim Y, Song J, Sung M, Chang E, Noh K, An S, Lee M, Song K, Lee H, Kim R, Shin Y, Oh D, Choi Y
Cancer Research and Treatment 2021;53(1):9-24
Cancer Research and Treatment 2021;53(1):9-24
No comments: Submit comment
No validations: Submit validation data