H00084498-B01

FAM120B antibody from Abnova Corporation
CCPG, KIAA1838, PGCC1, SAN1

Antibody data

Product number
H00084498-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084498-B01, RRID:AB_1204573
Product name
KIAA1838 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00084498-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KIAA1838 protein.
Antigen sequence
MGVRGLQGFVGSTCPHICTVVNFKELAEHHRSKYP
GCTPTIVVDAMCCLRYWYTPESWICGGQWREYFSA
LRDFVKTFTAAGIKLIFFFDGMVEQDKRDEWVKRR
LKNNREISRIFHYIKSHKEQPGRNMFFIPSGLAVF
TRFALKTLGQETLCSLQEADYEVASYGLQHNCLGI
LGEDTDYLIYDTCPYFSISELCLESLDTVMLCREK
LCESLGLCVADLPLLACLLGNDIIPEGMFESFRYK
CLSSYTSVKENFDKKGNIILAVSDHISKVLYLYQG
EKKLEEILPLGPNKALFYKGMASYLLPGQKSPWFF
QKPKGVITLDKQVISTSSDAESREEVPMCSDAESR
QEVPMCTGPESRREVPVYTDSEPRQEVPMCSDPEP
RQEVPTCTGPESRREVPMCSDPEPRQEVPMCTGPE
ARQEVPMYTDSEPRQEVPMYTDSEPRQEVPMYTGS
EPRQEVPMYTGPESRQEVPMYTGPESRQEVLIRTD
PESRQEIMCTGHESKQEVPICTDPISKQEDSMCTH
AEINQKLPVATDFEFKLEALMCTNPEIKQEDPTNV
GPEVKQQVTMVSDTEILKVARTHHVQAESYLVYNI
MSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVY
SLLLEDCQDVTSTCLAVKEWFVYPGNPLRHPDLVR
PLQMTIPGGTPSLKILWLNQEPEIQVRRLDTLLAC
FNLSSSREELQAVESPFQALCCLLIYLFVQVDTLC
LEDLHAFIAQALCLQGKSTSQLVNLQPDYINPRAV
QLGSLLVRGLTTLVLVNSACGFPWKTSDFMPWNVF
DGKLFHQKYLQSEKGYAVEVLLEQNRSRLTKFHNL
KAVVCKACMKENRRITGRAHWGSHHAGRWGRQGSS
YHRTGSGYSRSSQGQPWRDQGPGSRQYEHDQWRRY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -