HPA028020

ODF2L antibody from Atlas Antibodies
KIAA1229

Antibody data

Product number
HPA028020
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028020, RRID:AB_10601670
Product name
Anti-ODF2L
Provider product page
Atlas Antibodies - HPA028020
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLLPLFKDTIEKINFENANLSALNLKISEQKEILI
KELDTFKSVKLALEHLLRKRDYKQTGDNLSSMLLE
NLTDNESENTNLKKKVFEKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.