HPA028095

ODF2L antibody from Sigma-Aldrich
KIAA1229
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028095
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028095, RRID:AB_10611385
Product name
Anti-ODF2L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028095
Antibody type
Polyclonal
Antigen
outer dense fiber of sperm tails 2-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVKVVHERLQIQIHKREAENDKLKEYVKSLETKIA
KWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYK
QRLDHFTGAIE
Storage
-20C
Provider Type Product Number
- No reagents -