Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA047192 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA047192, RRID:AB_2679977
- Product name
- Anti-CLCA2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EELTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQD
DFNNAILVNTSKRNPQQAGIREIFTFSPQISTNGP
EHQPNGETHESHRIYVAIRAMDRNSLQSAVSNIAQ
APLFIPPNSDPVPARDYLILKGVLTAMGL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Transport of CLCA2 to the nucleus by extracellular vesicles controls keratinocyte survival and migration
CLCA2: A Potential Guardian against Premature Senescence and Skin Aging
CLCA2 suppresses the proliferation, migration and invasion of cervical cancer
Along with its favorable prognostic role, CLCA2 inhibits growth and metastasis of nasopharyngeal carcinoma cells via inhibition of FAK/ERK signaling
Seltmann K, Hettich B, Abele S, Gurri S, Mantella V, Leroux J, Werner S
Journal of Extracellular Vesicles 2024;13(4)
Journal of Extracellular Vesicles 2024;13(4)
CLCA2: A Potential Guardian against Premature Senescence and Skin Aging
Guerrero-Navarro L, Martic I, Ploner C, Jansen-Dürr P, Cavinato M
Biomedicines 2024;12(3):592
Biomedicines 2024;12(3):592
CLCA2 suppresses the proliferation, migration and invasion of cervical cancer
Zhang P, Lin Y, Liu Y
Experimental and Therapeutic Medicine 2021;22(1)
Experimental and Therapeutic Medicine 2021;22(1)
Along with its favorable prognostic role, CLCA2 inhibits growth and metastasis of nasopharyngeal carcinoma cells via inhibition of FAK/ERK signaling
Qiang Y, Li C, Sun R, Zheng L, Peng L, Yang J, Meng D, Lang Y, Mei Y, Xie P, Xu L, Cao Y, Wei W, Cao L, Hu H, Yang Q, Luo D, Liang Y, Huang B, Qian C
Journal of Experimental & Clinical Cancer Research 2018;37(1)
Journal of Experimental & Clinical Cancer Research 2018;37(1)
No comments: Submit comment
No validations: Submit validation data