Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00083939-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00083939-M01, RRID:AB_606166
- Product name
- EIF2A monoclonal antibody (M01), clone 3D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EIF2A.
- Antigen sequence
MAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRES
GKNCKVCIFSKDGTLFAWGNGEKVNIISVTNKGLL
HSFDLLKAVCLEFSPKNTVLATWQPYTTSK- Isotype
- IgG
- Antibody clone number
- 3D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Protein kinase R is responsible for the phosphorylation of eIF2alpha in rotavirus infection.
Rojas M, Arias CF, López S
Journal of virology 2010 Oct;84(20):10457-66
Journal of virology 2010 Oct;84(20):10457-66
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EIF2A expression in transfected 293T cell line by EIF2A monoclonal antibody (M01), clone 3D5.Lane 1: EIF2A transfected lysate(65 KDa).Lane 2: Non-transfected lysate.