Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003176-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003176-M03, RRID:AB_530082
- Product name
- HNMT monoclonal antibody (M03), clone 3G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HNMT.
- Antigen sequence
KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECY
DLLSTMDISDCFIDGNENGDLLWDFLTETCNFNAT
APPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFI
VIEA- Isotype
- IgG
- Antibody clone number
- 3G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HNMT monoclonal antibody (M03), clone 3G12 Western Blot analysis of HNMT expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HNMT is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol