HPA000570

OTC antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000570
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000570, RRID:AB_1079534
Product name
Anti-OTC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000570
Antibody type
Polyclonal
Antigen
Ornithine carbamoyltransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK
GEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLG
GHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLA
R
Storage
-20C
Provider Type Product Number
- No reagents -