HPA024426

IL33 antibody from Atlas Antibodies
C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024426
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024426, RRID:AB_1845820
Product name
Anti-IL33
Provider product page
Atlas Antibodies - HPA024426
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
STVECFAFGISGVQKYTRALHDSSITGISPITEYL
ASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDK
VLLSYYESQHPSNESGDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -