HPA024426
antibody from Atlas Antibodies
Targeting: IL33
C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024426 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024426, RRID:AB_1845820
- Product name
- Anti-IL33
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
STVECFAFGISGVQKYTRALHDSSITGISPITEYL
ASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDK
VLLSYYESQHPSNESGDG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Severe obesity increases adipose tissue expression of interleukin-33 and its receptor ST2, both predominantly detectable in endothelial cells of human adipose tissue
Zeyda M, Wernly B, Demyanets S, Kaun C, Hämmerle M, Hantusch B, Schranz M, Neuhofer A, Itariu B, Keck M, Prager G, Wojta J, Stulnig T
International Journal of Obesity 2012 July;37(5):658-665
International Journal of Obesity 2012 July;37(5):658-665
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and IL33 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409498).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows nuclear positivity in endothelial cells.
- Sample type
- HUMAN