H00090865-M01

IL33 antibody from Abnova Corporation
C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV

Antibody data

Product number
H00090865-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00090865-M01, RRID:AB_1571877
Product name
IL33 monoclonal antibody (M01), clone 2D8
Provider product page
Abnova Corporation - H00090865-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant IL33.
Antigen sequence
NESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVEL
HKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI
GVKDNHLALIKVDSSENLCTENILFKLSE
Isotype
IgG
Antibody clone number
2D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -