HPA024426

IL33 antibody from Sigma-Aldrich
C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024426
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024426, RRID:AB_1845820
Product name
Anti-IL33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024426
Antibody type
Polyclonal
Antigen
Interleukin-33 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STVECFAFGISGVQKYTRALHDSSITGISPITEYL
ASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDK
VLLSYYESQHPSNESGDG
Storage
-20C
Provider Type Product Number
- No reagents -