HPA053524

antibody from Atlas Antibodies

Targeting: MAVS Cardif, IPS-1, KIAA1271, VISA

Antibody data

Submit

Validation data

Product number: HPA053524 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA053524, RRID:AB_2682177
Product name: Anti-MAVS
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGM GPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPG PPADPDGGPRPQADRK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MAVS protein structure - HPA053524 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human rectum and liver tissues using Anti-MAVS antibody. Corresponding MAVS RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-MAVS antibody HPA053524 (A) shows similar protein distribution across tissues to independent antibody HPA049850 (B).
Antibody #2 product nr: HPA049850
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MAVS antibody HPA053524.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MAVS antibody HPA053524.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MAVS antibody HPA053524.
Sample type: HUMAN