Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009197-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009197-M07, RRID:AB_566190
- Product name
- SLC33A1 monoclonal antibody (M07), clone 3A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC33A1.
- Antigen sequence
MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGW
DDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR- Isotype
- IgG
- Antibody clone number
- 3A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SLC33A1/AT-1 protein regulates the induction of autophagy downstream of IRE1/XBP1 pathway.
AT-1 is the ER membrane acetyl-CoA transporter and is essential for cell viability.
Pehar M, Jonas MC, Hare TM, Puglielli L
The Journal of biological chemistry 2012 Aug 24;287(35):29921-30
The Journal of biological chemistry 2012 Aug 24;287(35):29921-30
AT-1 is the ER membrane acetyl-CoA transporter and is essential for cell viability.
Jonas MC, Pehar M, Puglielli L
Journal of cell science 2010 Oct 1;123(Pt 19):3378-88
Journal of cell science 2010 Oct 1;123(Pt 19):3378-88
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SLC33A1 monoclonal antibody (M07), clone 3A4 Western Blot analysis of SLC33A1 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4.Lane 1: SLC33A1 transfected lysate(60.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SLC33A1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol