Antibody data

Product number
ABIN503559
Provider
antibodies-online
Product name
anti-Kinesin Family Member 5C (KIF5C) antibody
Provider product page
antibodies-online - ABIN503559
Antibody type
Polyclonal
Antigen
The immunogen for anti-KIF5C antibody: synthetic peptide directed towards the N terminal of human KIF5C
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGD
ETVVI GQGKPYVFDR
Vial size
50 µg
Provider Type Product Number
- No reagents -