PAB15721

antibody from Abnova Corporation

Targeting: KIF5C

No application information provided.

Antibody Data

Product number

PAB15721

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#PAB15721, RRID:AB_10676893

Product name

Kif5c polyclonal antibody

Antibody type

Polyclonal

Description

Rabbit polyclonal antibody raised against partial recombinant Kif5c.

Antigen sequence

VKALESALKEAKENAMRDRKRYQQEVDRIKEAVRA
KNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGG
GGGSSNSTHYQK


Storage

Store at -20°C.Aliquot to avoid repeated freezing and thawing.

References

Submitted references

A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.

Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304

---

High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.

Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36

---

KIF5C, a novel neuronal kinesin enriched in motor neurons.

Kanai Y, Okada Y, Tanaka Y, Harada A, Terada S, Hirokawa N
The Journal of neuroscience : the official journal of the Society for Neuroscience 2000 Sep 1;20(17):6374-84