Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008833-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008833-M01, RRID:AB_509389
- Product name
- GMPS monoclonal antibody (M01), clone 1D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GMPS.
- Antigen sequence
QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRG
LQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGI
ANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAG
CSG- Isotype
- IgG
- Antibody clone number
- 1D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.
Nogueira da Costa A, Mijal RS, Keen JN, Findlay JB, Wild CP
Proteomics 2011 May;11(10):1903-14
Proteomics 2011 May;11(10):1903-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GMPS is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GMPS on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol