H00010673-M19

TNFSF13B antibody from Abnova Corporation
BAFF, BLYS, CD257, TALL-1, TALL1, THANK, TNFSF20

Antibody data

Product number
H00010673-M19
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010673-M19, RRID:AB_1137498
Product name
TNFSF13B monoclonal antibody (M19), clone 3G6
Provider product page
Abnova Corporation - H00010673-M19
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TNFSF13B.
Antigen sequence
PAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIAD
SETPTIQKGSYTFVPWLLSFKRGSALEEKENKILV
KETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGD
Isotype
IgG
Antibody clone number
3G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -