Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005806-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005806-M02, RRID:AB_606891
- Product name
- PTX3 monoclonal antibody (M02), clone 2B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTX3.
- Antigen sequence
SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNG
CCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRET
GGAESCHIRGNIVGWGVTEIQPHGGAQYV- Isotype
- IgG
- Antibody clone number
- 2B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Repetitive hyperthermia attenuates progression of left ventricular hypertrophy and increases telomerase activity in hypertensive rats.
Oyama J, Maeda T, Sasaki M, Higuchi Y, Node K, Makino N
American journal of physiology. Heart and circulatory physiology 2012 May 15;302(10):H2092-101
American journal of physiology. Heart and circulatory physiology 2012 May 15;302(10):H2092-101
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PTX3 monoclonal antibody (M02), clone 2B10. Western Blot analysis of PTX3 expression in U-2 OS.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PTX3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PTX3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol