H00022861-B01P

NLRP1 antibody from Abnova Corporation
CARD7, CLR17.1, DEFCAP, DKFZp586O1822, KIAA0926, NAC, NALP1, SLEV1, VAMAS1

Antibody data

Product number
H00022861-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022861-B01P, RRID:AB_1578067
Product name
NLRP1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00022861-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NLRP1 protein.
Antigen sequence
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSR
SSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLA
LHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHL
GSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQL
PDTSGRRWREISASLLYQALPSSPDHESPSQESPN
APTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDE
TSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAH
TSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQ
LLLLQRPHPRSQDPLVKRSWPDYVEENRGHLIEIR
DLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEA
WGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIG
KDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFL
ITARTTALQNLIPSLEQARWVEVLGFSESSRKEYF
YRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWL
ACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQ
AQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHG
LDGAIISTFLKMGILQEHPIPLSYSFIHLCFQEFF
AAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGL
FGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNL
MQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVM
AHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLI
EGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLK
VTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLE
TLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFN
VLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTSDC
CQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEG
LRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQ
LLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRL
GSERAASHVAQANLKLLDVSKIFPIAEIAEESSPE
VVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGP
VATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMR
EAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIK
AEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEE
GMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNA
LRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIR
KELELCYRSPGEDQLFSEFYVGHLGSGIRLQVKDK
KDETLVWEALVKPGDLMPATTLIPPARIAVPSPLD
APQLLHFVDQYREQLIARVTSVEVVLDKLHGQVLS
QEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGL
YQALKETHPHLIMELWEKGSKKGLLPLSS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -