HPA028035

CCDC18 antibody from Sigma-Aldrich
NY-SAR-41
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028035
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028035, RRID:AB_10601795
Product name
Anti-CCDC18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028035
Antibody type
Polyclonal
Antigen
coiled-coil domain containing 18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTK
LIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASN
SSKLESEMTKKCSQLLTLEKQLEEKI
Storage
-20C
Provider Type Product Number
- No reagents -