Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA045142 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA045142, RRID:AB_2679231
- Product name
- Anti-TNFSF11
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PNRISEDGTHCIYRILRLHENADFQDTTLESQDTK
LIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKA
MVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Role of RANK-L as a potential inducer of ILC2-mediated type 2 inflammation in chronic rhinosinusitis with nasal polyps
The relationship between Tāhelper cell polarization and the RANKL/OPG ratio in gingival tissues from chronic periodontitis patients
Ogasawara N, Poposki J, Klingler A, Tan B, Hulse K, Stevens W, Peters A, Grammer L, Welch K, Smith S, Conley D, Raviv J, Soroosh P, Takano K, Himi T, Kern R, Schleimer R, Kato A
Mucosal Immunology 2020;13(1):86-95
Mucosal Immunology 2020;13(1):86-95
The relationship between Tāhelper cell polarization and the RANKL/OPG ratio in gingival tissues from chronic periodontitis patients
Bi C, Sun L, Qu H, Chen F, Tian B, Chen F
Clinical and Experimental Dental Research 2019;5(4):377-388
Clinical and Experimental Dental Research 2019;5(4):377-388
No comments: Submit comment
No validations: Submit validation data