H00008600-M17

TNFSF11 antibody from Abnova Corporation
CD254, ODF, OPGL, RANKL, TRANCE

Antibody data

Product number
H00008600-M17
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008600-M17, RRID:AB_1581477
Product name
TNFSF11 monoclonal antibody (M17), clone 3F7
Provider product page
Abnova Corporation - H00008600-M17
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TNFSF11.
Antigen sequence
FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLM
KGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISI
EVSNPSLLDPDQDATYFGAFKVRDI
Isotype
IgG
Antibody clone number
3F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -