HPA034742

ARL14 antibody from MilliporeSigma / Merck KGaA
ARF7, FLJ22595
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034742
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034742, RRID:AB_10611677
Product name
Anti-ARL14 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034742
Antibody type
Polyclonal
Antigen
ADP-ribosylation factor-like 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKN
EHIKNVPVVLLANKQD
Storage
-20C
Provider Type Product Number
- No reagents -