HPA027002

ARL5A antibody from MilliporeSigma / Merck KGaA
ARL5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027002
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027002, RRID:AB_10601685
Product name
Anti-ARL5A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027002
Antibody type
Polyclonal
Antigen
ADP-ribosylation factor-like 5A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QESLRSSWNTYYTNTEFVIVVVDSTDRERISVTRE
ELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEIS
QFLKLTSIKDHQWHIQACCALTGEGLCQGL
Storage
-20C
Provider Type Product Number
- No reagents -