HPA035019

NMD3 antibody from MilliporeSigma / Merck KGaA
CGI-07
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035019
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035019, RRID:AB_10600922
Product name
Anti-NMD3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035019
Antibody type
Polyclonal
Antigen
NMD3 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPICKDNVVCLSPKLAQSLGNMNQICVCIRVTSAI
HLIDPNTLQVADIDGSTFWSHPFNSLCHPKQLEEF
IVMECSIVQDIKRAA
Storage
-20C
Provider Type Product Number
- No reagents -