Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010254-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010254-M01, RRID:AB_607104
- Product name
- STAM2 monoclonal antibody (M01), clone 1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STAM2.
- Antigen sequence
QSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLS
TGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSV
DMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYH
QQPLL- Isotype
- IgG
- Antibody clone number
- 1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STAM2 monoclonal antibody (M01), clone 1A10 Western Blot analysis of STAM2 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STAM2 expression in transfected 293T cell line by STAM2 monoclonal antibody (M01), clone 1A10.Lane 1: STAM2 transfected lysate (Predicted MW: 58.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STAM2 is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of STAM2 transfected lysate using anti-STAM2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with STAM2 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol