HPA035528

STAM2 antibody from MilliporeSigma / Merck KGaA
Hbp
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035528
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035528, RRID:AB_10601606
Product name
Anti-STAM2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035528
Antibody type
Polyclonal
Antigen
signal transducing adaptor molecule (SH3 domain and ITAM motif) 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHG
GNYMGQSIHQVTVAQSYSLGPDQIGPLRSLPPNVN
SSVTA
Storage
-20C
Provider Type Product Number
- No reagents -