HPA030613

SERPINI2 antibody from MilliporeSigma / Merck KGaA
MEPI, PANCPIN, PI14, TSA2004
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030613
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030613, RRID:AB_10602225
Product name
Anti-SERPINI2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030613
Antibody type
Polyclonal
Antigen
serpin peptidase inhibitor, clade I (pancpin), member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYQEVSLSHKDNIIFSPLGITLVLEMVQLGAKGKA
QQQIRQTLKQQETSAGEEFFVLKSFFSAISEKKQE
FTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKL
VDFQDAKACAEMISTWVERKTDGKIKDMFSGEEFG
PLTRLVL
Storage
-20C
Provider Type Product Number
- No reagents -