HPA028443

LRRC39 antibody from MilliporeSigma / Merck KGaA
MGC14816, myomasp
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028443
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028443, RRID:AB_10611117
Product name
Anti-LRRC39 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028443
Antibody type
Polyclonal
Antigen
leucine rich repeat containing 39 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTTIPLAVLNMPALEWLDMGSNKLEQLPDTIERMQ
NLHTLWLQRNEITCLPQTISNMKNLGTLVLSNNKL
QD
Storage
-20C
Provider Type Product Number
- No reagents -