Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405329 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RNA terminal Phosphate Cyclase Domain 1 (RTCD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RTCD1 antibody: synthetic peptide directed towards the N terminal of human RTCD1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGA
EIGST EITFTPEKIK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The human RNA 3'-terminal phosphate cyclase is a member of a new family of proteins conserved in Eucarya, Bacteria and Archaea.
Genschik P, Billy E, Swianiewicz M, Filipowicz W
The EMBO journal 1997 May 15;16(10):2955-67
The EMBO journal 1997 May 15;16(10):2955-67
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: RTCA Sample Tissue: Human Fetal Brain Antibody Dilution: 1.0 μg/mL