HPA028151

RTCA antibody from Sigma-Aldrich
RPC, RTC1, RTCD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028151
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028151, RRID:AB_10602099
Product name
Anti-RTCD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028151
Antibody type
Polyclonal
Antigen
RNA terminal phosphate cyclase domain 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQL
EGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLL
MQVSMPCV
Storage
-20C
Provider Type Product Number
- No reagents -