Antibody data

Product number
H00114805-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00114805-M04, RRID:AB_1575069
Product name
GALNT13 monoclonal antibody (M04), clone 3F3
Provider product page
Abnova Corporation - H00114805-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GALNT13.
Antigen sequence
RAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKIN
QFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPN
TSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVI
Isotype
IgG
Antibody clone number
3F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -