HPA017437

CTPS2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017437
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017437, RRID:AB_1847326
Product name
Anti-CTPS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017437
Antibody type
Polyclonal
Antigen
CTP synthase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVP
LVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRK
LYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVG
QDVDGD
Storage
-20C
Provider Type Product Number
- No reagents -