Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA052246 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-COL11A1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDL
GEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITE
T- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A human multi-cellular model shows how platelets drive production of diseased extracellular matrix and tissue invasion
Modelling TGFβR and Hh pathway regulation of prognostic matrisome molecules in ovarian cancer
Mouse Ovarian Cancer Models Recapitulate the Human Tumor Microenvironment and Patient Response to Treatment
Malacrida B, Nichols S, Maniati E, Jones R, Delanie-Smith R, Roozitalab R, Tyler E, Thomas M, Boot G, Mackerodt J, Lockley M, Knight M, Balkwill F, Pearce O
iScience 2021;24(6):102676
iScience 2021;24(6):102676
Modelling TGFβR and Hh pathway regulation of prognostic matrisome molecules in ovarian cancer
Delaine-Smith R, Maniati E, Malacrida B, Nichols S, Roozitalab R, Jones R, Lecker L, Pearce O, Knight M, Balkwill F
iScience 2021;24(6):102674
iScience 2021;24(6):102674
Mouse Ovarian Cancer Models Recapitulate the Human Tumor Microenvironment and Patient Response to Treatment
Maniati E, Berlato C, Gopinathan G, Heath O, Kotantaki P, Lakhani A, McDermott J, Pegrum C, Delaine-Smith R, Pearce O, Hirani P, Joy J, Szabova L, Perets R, Sansom O, Drapkin R, Bailey P, Balkwill F
Cell Reports 2020;30(2):525-540.e7
Cell Reports 2020;30(2):525-540.e7
No comments: Submit comment
No validations: Submit validation data