HPA035225

UPP2 antibody from MilliporeSigma / Merck KGaA
UDRPASE2, UP2, UPASE2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035225
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035225, RRID:AB_10604002
Product name
Anti-UPP2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035225
Antibody type
Polyclonal
Antigen
uridine phosphorylase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTR
STELDKELSEELFNCSKEIPNFPTLVGHTMCT
Storage
-20C
Provider Type Product Number
- No reagents -