Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008502-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008502-M01, RRID:AB_875788
- Product name
- PKP4 monoclonal antibody (M01), clone 1B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PKP4.
- Antigen sequence
EGQPQTRQEAASTGPGMEPETTATTILASVKEQEL
QFQRLTRELEVERQIVASQLERCRLGAESPSIAST
SSTEKSFPWRSTDVPNTGVSKPRVSDAVQ- Isotype
- IgG
- Antibody clone number
- 1B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A molecular study of desmosomes identifies a desmoglein isoform switch in head and neck squamous cell carcinoma.
Teh MT, Parkinson EK, Thurlow JK, Liu F, Fortune F, Wan H
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2011 Jan;40(1):67-76
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2011 Jan;40(1):67-76
No comments: Submit comment
No validations: Submit validation data