Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000276-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000276-M04, RRID:AB_565469
- Product name
- AMY1A monoclonal antibody (M04), clone 2D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AMY1A.
- Antigen sequence
VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGV
AGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGS
KPFI- Isotype
- IgG
- Antibody clone number
- 2D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AMY1A monoclonal antibody (M04), clone 2D4. Western Blot analysis of AMY1A expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AMY1A is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to AMY1A on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
