HPA022152

MARCHF7 antibody from Sigma-Aldrich
AXOT, MARCH-VII, MARCH7, RNF177
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022152
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022152, RRID:AB_10601107
Product name
Anti-MARCH7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022152
Antibody type
Polyclonal
Antigen
membrane-associated ring finger (C3HC4) 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSRSNTQPGFSYSSSRDEAPIISNSERVVSSQRPF
QESSDNEGRRTTRRLLSRIASSMSSTFFSRRSSQD
SLNTRSLNSENSYVSPRILTASQSRSNVPSASEVP
DNRASEASQGFRFLRRRWGLSSLSHNHSSESDSEN
FNQESE
Storage
-20C
Provider Type Product Number
- No reagents -