HPA030270

AKNAD1 antibody from MilliporeSigma / Merck KGaA
C1orf62, MGC26989
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030270
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030270, RRID:AB_10610980
Product name
Anti-C1orf62 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030270
Antibody type
Polyclonal
Antigen
AKNA domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEEAIIKSIISCYNKNSWPKEQTPELTDQLNPKRD
GENSNKPGSATTTEENTSDLEGPVAAGDSSHQENV
NVLTKTKGP
Storage
-20C
Provider Type Product Number
- No reagents -