HPA027289

WDR47 antibody from MilliporeSigma / Merck KGaA
KIAA0893
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027289
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027289, RRID:AB_10601862
Product name
Anti-WDR47 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027289
Antibody type
Polyclonal
Antigen
WD repeat domain 47 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCIN
ILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYP
DVIDPSAHETPKQPVV
Storage
-20C
Provider Type Product Number
- No reagents -