Antibody data
- Antibody Data
- Antigen structure
- References [13]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055669-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055669-M04, RRID:AB_581724
- Product name
- MFN1 monoclonal antibody (M04), clone 3C9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MFN1.
- Antigen sequence
MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHF
VEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEV
LSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGI
GHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVN
QLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLV
LVDSPGTDVTTELDSWIDKFCLDADVFVLVANSES
TLMNTEKHFFHKVNERLSKPNIFILNNRWDASASE
PEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRI
FFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQ
EFQNFEQIFEECISQSAVKTKFEQHTIRAKQILAT
VKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRN
QMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRL
SVLVDEFCSEFHPNPDVLKIYKSELNKHIEDGMGR
NLADRCTDEVNALVLQTQQEIIENLKPLLPAGIQD
KLHTLIPCKKFDLSYNLNYHKLCSDFQEDIVFRFS
LGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLA
STPTAPTTPATPDNASQEELMITLVTGLASVTSRT
SMGIIIVGGVIWKTIGWKLLSVSLTMYGALYLYER
LSWTTHAKERAFKQQFVNYATEKLRMIVSSTSANC
SHQVKQQIATTFARLCQQVDITQKQLEEEIARLPK
EIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLP
SSNEES- Isotype
- IgG
- Antibody clone number
- 3C9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Lysine 63-linked polyubiquitination is dispensable for Parkin-mediated mitophagy.
A small natural molecule promotes mitochondrial fusion through inhibition of the deubiquitinase USP30.
Phosphatidic acid (PA)-preferring phospholipase A1 regulates mitochondrial dynamics.
Atad3 function is essential for early post-implantation development in the mouse.
Regulation of miRNAs in human skeletal muscle following acute endurance exercise and short-term endurance training.
Dynamics of nucleoid structure regulated by mitochondrial fission contributes to cristae reformation and release of cytochrome c.
Suppressor of cytokine signaling 6 (SOCS6) promotes mitochondrial fission via regulating DRP1 translocation.
Extramitochondrial OPA1 and adrenocortical function.
TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
PINK1-mediated phosphorylation of the Parkin ubiquitin-like domain primes mitochondrial translocation of Parkin and regulates mitophagy.
Rab32 modulates apoptosis onset and mitochondria-associated membrane (MAM) properties.
PGC-1alpha's relationship with skeletal muscle palmitate oxidation is not present with obesity despite maintained PGC-1alpha and PGC-1beta protein.
OPA1 mutations associated with dominant optic atrophy impair oxidative phosphorylation and mitochondrial fusion.
Shiba-Fukushima K, Inoshita T, Hattori N, Imai Y
The Journal of biological chemistry 2014 Nov 28;289(48):33131-6
The Journal of biological chemistry 2014 Nov 28;289(48):33131-6
A small natural molecule promotes mitochondrial fusion through inhibition of the deubiquitinase USP30.
Yue W, Chen Z, Liu H, Yan C, Chen M, Feng D, Yan C, Wu H, Du L, Wang Y, Liu J, Huang X, Xia L, Liu L, Wang X, Jin H, Wang J, Song Z, Hao X, Chen Q
Cell research 2014 Apr;24(4):482-96
Cell research 2014 Apr;24(4):482-96
Phosphatidic acid (PA)-preferring phospholipase A1 regulates mitochondrial dynamics.
Baba T, Kashiwagi Y, Arimitsu N, Kogure T, Edo A, Maruyama T, Nakao K, Nakanishi H, Kinoshita M, Frohman MA, Yamamoto A, Tani K
The Journal of biological chemistry 2014 Apr 18;289(16):11497-511
The Journal of biological chemistry 2014 Apr 18;289(16):11497-511
Atad3 function is essential for early post-implantation development in the mouse.
Goller T, Seibold UK, Kremmer E, Voos W, Kolanus W
PloS one 2013;8(1):e54799
PloS one 2013;8(1):e54799
Regulation of miRNAs in human skeletal muscle following acute endurance exercise and short-term endurance training.
Russell AP, Lamon S, Boon H, Wada S, Güller I, Brown EL, Chibalin AV, Zierath JR, Snow RJ, Stepto N, Wadley GD, Akimoto T
The Journal of physiology 2013 Sep 15;591(18):4637-53
The Journal of physiology 2013 Sep 15;591(18):4637-53
Dynamics of nucleoid structure regulated by mitochondrial fission contributes to cristae reformation and release of cytochrome c.
Ban-Ishihara R, Ishihara T, Sasaki N, Mihara K, Ishihara N
Proceedings of the National Academy of Sciences of the United States of America 2013 Jul 16;110(29):11863-8
Proceedings of the National Academy of Sciences of the United States of America 2013 Jul 16;110(29):11863-8
Suppressor of cytokine signaling 6 (SOCS6) promotes mitochondrial fission via regulating DRP1 translocation.
Lin HY, Lai RH, Lin ST, Lin RC, Wang MJ, Lin CC, Lee HC, Wang FF, Chen JY
Cell death and differentiation 2013 Jan;20(1):139-53
Cell death and differentiation 2013 Jan;20(1):139-53
Extramitochondrial OPA1 and adrenocortical function.
Fülöp L, Rajki A, Katona D, Szanda G, Spät A
Molecular and cellular endocrinology 2013 Dec 5;381(1-2):70-9
Molecular and cellular endocrinology 2013 Dec 5;381(1-2):70-9
TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
Takamura H, Koyama Y, Matsuzaki S, Yamada K, Hattori T, Miyata S, Takemoto K, Tohyama M, Katayama T
PloS one 2012;7(12):e51912
PloS one 2012;7(12):e51912
PINK1-mediated phosphorylation of the Parkin ubiquitin-like domain primes mitochondrial translocation of Parkin and regulates mitophagy.
Shiba-Fukushima K, Imai Y, Yoshida S, Ishihama Y, Kanao T, Sato S, Hattori N
Scientific reports 2012;2:1002
Scientific reports 2012;2:1002
Rab32 modulates apoptosis onset and mitochondria-associated membrane (MAM) properties.
Bui M, Gilady SY, Fitzsimmons RE, Benson MD, Lynes EM, Gesson K, Alto NM, Strack S, Scott JD, Simmen T
The Journal of biological chemistry 2010 Oct 8;285(41):31590-602
The Journal of biological chemistry 2010 Oct 8;285(41):31590-602
PGC-1alpha's relationship with skeletal muscle palmitate oxidation is not present with obesity despite maintained PGC-1alpha and PGC-1beta protein.
Holloway GP, Perry CG, Thrush AB, Heigenhauser GJ, Dyck DJ, Bonen A, Spriet LL
American journal of physiology. Endocrinology and metabolism 2008 Jun;294(6):E1060-9
American journal of physiology. Endocrinology and metabolism 2008 Jun;294(6):E1060-9
OPA1 mutations associated with dominant optic atrophy impair oxidative phosphorylation and mitochondrial fusion.
Zanna C, Ghelli A, Porcelli AM, Karbowski M, Youle RJ, Schimpf S, Wissinger B, Pinti M, Cossarizza A, Vidoni S, Valentino ML, Rugolo M, Carelli V
Brain : a journal of neurology 2008 Feb;131(Pt 2):352-67
Brain : a journal of neurology 2008 Feb;131(Pt 2):352-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MFN1 expression in transfected 293T cell line by MFN1 monoclonal antibody (M04), clone 3C9.Lane 1: MFN1 transfected lysate(84.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MFN1 monoclonal antibody (M04), clone 3C9. Western Blot analysis of MFN1 expression in HepG2.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MFN1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol