Antibody data

Product number
H00006884-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006884-M02, RRID:AB_1137485
Product name
TAF13 monoclonal antibody (M02), clone 2B3
Provider product page
Abnova Corporation - H00006884-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TAF13.
Antigen sequence
KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLV
IEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRK
FARVKDLLTMNEELKRARKAFDEANYGS
Isotype
IgG
Antibody clone number
2B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -