H00029108-B02P

PYCARD antibody from Abnova Corporation
ASC, CARD5, TMS-1

Antibody data

Product number
H00029108-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029108-B02P, RRID:AB_1579443
Product name
PYCARD purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00029108-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PYCARD protein.
Antigen sequence
MGRARDAILDALENLTAEELKKFKLKLLSVPLREG
YGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA
NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQ
SAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV
LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKD
LLLQALRESQSYLVEDLERS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -