Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA059739 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA059739, RRID:AB_2684117
- Product name
- Anti-FAP
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDE
ITLWYKM- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Fibroblast activation and inflammation in frozen shoulder
Fibroblasts in the Tumor Microenvironment: Shield or Spear?
Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Head and Neck Cancer
Mohamadi A, Akbar M, McLean M, Garcia-Melchor E, Crowe L, McMillan P, Fazzi U, Martin D, Arthur A, Reilly J, McInnes I, Millar N
PLOS ONE 2019;14(4):e0215301
PLOS ONE 2019;14(4):e0215301
Fibroblasts in the Tumor Microenvironment: Shield or Spear?
Alkasalias T, Moyano-Galceran L, Arsenian-Henriksson M, Lehti K
International Journal of Molecular Sciences 2018;19(5):1532
International Journal of Molecular Sciences 2018;19(5):1532
Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Head and Neck Cancer
Puram S, Tirosh I, Parikh A, Patel A, Yizhak K, Gillespie S, Rodman C, Luo C, Mroz E, Emerick K, Deschler D, Varvares M, Mylvaganam R, Rozenblatt-Rosen O, Rocco J, Faquin W, Lin D, Regev A, Bernstein B
Cell 2017;171(7):1611-1624.e24
Cell 2017;171(7):1611-1624.e24
No comments: Submit comment
No validations: Submit validation data