Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002191-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002191-M01, RRID:AB_489736
- Product name
- FAP monoclonal antibody (M01), clone 1E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FAP.
- Antigen sequence
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWIS
YLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGV
YEVEDQITAVRKFIEMGFIDEKRIAIWGWS- Isotype
- IgG
- Antibody clone number
- 1E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Fibroblast activation protein (FAP) is essential for the migration of bone marrow mesenchymal stem cells through RhoA activation.
Extracellular Hsp90 mediates an NF-κB dependent inflammatory stromal program: implications for the prostate tumor microenvironment.
Fibroblast activation protein and chronic liver disease.
Differential impact of TGF-beta and EGF on fibroblast differentiation and invasion reciprocally promotes colon cancer cell invasion.
Chung KM, Hsu SC, Chu YR, Lin MY, Jiaang WT, Chen RH, Chen X
PloS one 2014;9(2):e88772
PloS one 2014;9(2):e88772
Extracellular Hsp90 mediates an NF-κB dependent inflammatory stromal program: implications for the prostate tumor microenvironment.
Bohonowych JE, Hance MW, Nolan KD, Defee M, Parsons CH, Isaacs JS
The Prostate 2014 Apr;74(4):395-407
The Prostate 2014 Apr;74(4):395-407
Fibroblast activation protein and chronic liver disease.
Wang XM, Yao TW, Nadvi NA, Osborne B, McCaughan GW, Gorrell MD
Frontiers in bioscience : a journal and virtual library 2008 Jan 1;13:3168-80
Frontiers in bioscience : a journal and virtual library 2008 Jan 1;13:3168-80
Differential impact of TGF-beta and EGF on fibroblast differentiation and invasion reciprocally promotes colon cancer cell invasion.
Denys H, Derycke L, Hendrix A, Westbroek W, Gheldof A, Narine K, Pauwels P, Gespach C, Bracke M, De Wever O
Cancer letters 2008 Aug 8;266(2):263-74
Cancer letters 2008 Aug 8;266(2):263-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FAP monoclonal antibody (M01), clone 1E5 Western Blot analysis of FAP expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FAP expression in transfected 293T cell line by FAP monoclonal antibody (M01), clone 1E5.Lane 1: FAP transfected lysate(87.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FAP is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FAP transfected lysate using anti-FAP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FAP MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol