H00002191-M05

FAP antibody from Abnova Corporation
DPPIV
No application information provided.

Antibody data

Product number
H00002191-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002191-M05, RRID:AB_1237701
Product name
FAP monoclonal antibody (M05), clone 3C7
Provider product page
Abnova Corporation - H00002191-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FAP.
Antigen sequence
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWIS
YLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGV
YEVEDQITAVRKFIEMGFIDEKRIAIWGWS
Isotype
IgG
Antibody clone number
3C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -