Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003336-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003336-M01, RRID:AB_425497
- Product name
- HSPE1 monoclonal antibody (M01), clone 4C11-B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant HSPE1.
- Antigen sequence
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPE
KSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK
VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD- Isotype
- IgG
- Antibody clone number
- 4C11-B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HSPE1 monoclonal antibody (M01), clone 4C11-B11 Western Blot analysis of HSPE1 expression in COLO 320 HSR ( Cat # L020V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HSPE1 expression in transfected 293T cell line by HSPE1 monoclonal antibody (M01), clone 4C11-B11.Lane 1: HSPE1 transfected lysate(10.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HSPE1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HSPE1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol