Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000271-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000271-M01, RRID:AB_913259
- Product name
- AMPD2 monoclonal antibody (M01), clone 2F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AMPD2.
- Antigen sequence
ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQG
EGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTD
LLDAAKSVVRALFIREKYMALSLQSFCPTT- Isotype
- IgG
- Antibody clone number
- 2F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M01), clone 2F5.Lane 1: AMPD2 transfected lysate(92.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AMPD2 monoclonal antibody (M01), clone 2F5. Western Blot analysis of AMPD2 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AMPD2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol