Antibody data

Product number
H00000271-M04A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000271-M04A, RRID:AB_1571178
Product name
AMPD2 monoclonal antibody (M04A), clone 2G8
Provider product page
Abnova Corporation - H00000271-M04A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AMPD2.
Antigen sequence
ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQG
EGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTD
LLDAAKSVVRALFIREKYMALSLQSFCPTT
Isotype
IgG
Antibody clone number
2G8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -